PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma7g01540.1
Common NameZOSMA_7G01540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 198aa    MW: 22752.4 Da    PI: 10.5828
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma7g01540.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.44.6e-29959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien++nrqvtfskRrng+lKKA+ELSvLCdaeva++i+s++gk y +ss
  Zosma7g01540.1  9 KRIENSMNRQVTFSKRRNGLLKKAFELSVLCDAEVALVILSPSGKTYQFSS 59
                    79***********************************************96 PP

2K-box58.72.5e-20811729100
           K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                      +++  esl++e+++Lkk   + +  ++++ Ge+L s   +e +qLe+++ ++l++iR +K +ll+++i+ l+kk k+lq+en  L+++++e
  Zosma7g01540.1  81 IDARSVESLRNEVENLKKFAVSTEARLKQMCGEELASVGAREVKQLERHMRTGLQRIRVQKRRLLTDHIRMLKKKHKDLQDENAFLQQRMKE 172
                     55677899********************************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.015161IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-31275IPR002100Transcription factor, MADS-box
CDDcd002655.82E-38270No hitNo description
PRINTSPR004047.6E-30323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-303859IPR002100Transcription factor, MADS-box
PfamPF014861.5E-1784170IPR002487Transcription factor, K-box
PROSITE profilePS5129711.33386176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MGRGKVQLKR IENSMNRQVT FSKRRNGLLK KAFELSVLCD AEVALVILSP SGKTYQFSSN  60
DFDTTISKYR SMGGLPDLNE IDARSVESLR NEVENLKKFA VSTEARLKQM CGEELASVGA  120
REVKQLERHM RTGLQRIRVQ KRRLLTDHIR MLKKKHKDLQ DENAFLQQRM KEACKALEKR  180
QVNKPPGIFL QDLNEVY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-21269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-21269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-21269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-21269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A1e-21289187Myocyte-specific enhancer factor 2A
3kov_B1e-21289187Myocyte-specific enhancer factor 2A
3kov_I1e-21289187Myocyte-specific enhancer factor 2A
3kov_J1e-21289187Myocyte-specific enhancer factor 2A
3mu6_A6e-22271170Myocyte-specific enhancer factor 2A
3mu6_B6e-22271170Myocyte-specific enhancer factor 2A
3mu6_C6e-22271170Myocyte-specific enhancer factor 2A
3mu6_D6e-22271170Myocyte-specific enhancer factor 2A
3p57_A1e-21289187Myocyte-specific enhancer factor 2A
3p57_B1e-21289187Myocyte-specific enhancer factor 2A
3p57_C1e-21289187Myocyte-specific enhancer factor 2A
3p57_D1e-21289187Myocyte-specific enhancer factor 2A
3p57_I1e-21289187Myocyte-specific enhancer factor 2A
3p57_J1e-21289187Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012090674.16e-69PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X1
RefseqXP_012090675.15e-69PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X2
TrEMBLA0A0K9NNF21e-144A0A0K9NNF2_Z
STRINGVIT_17s0000g01230.t011e-62(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4174523
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.19e-42AGAMOUS-like 20